1. Search Result
Search Result
Results for "

antibiotic peptide

" in MedChemExpress (MCE) Product Catalog:

66

Inhibitors & Agonists

1

Biochemical Assay Reagents

52

Peptides

2

MCE Kits

10

Natural
Products

1

Isotope-Labeled Compounds

Cat. No. Product Name Target Research Areas Chemical Structure
  • HY-P5726

    Antibiotic Cancer
    Aurein 1.2 is an active amphibian antibiotic peptide with antibiotic and anticancer activities .
    Aurein 1.2
  • HY-P5728

    Bacterial Antibiotic Infection
    Aurein 1.1 is an antibiotic peptide that can be found in the Australian Bell Frogs Litoria raniformis .
    Aurein 1.1
  • HY-P5725

    Bacterial Antibiotic Infection
    Aurein 2.1 is an antibiotic peptide that can be found in the Australian Bell Frogs Litoria aurea and Litoria raniformis .
    Aurein 2.1
  • HY-147429A

    Abx MCP TFA; RG6006 TFA

    Antibiotic Bacterial Infection
    Zosurabalpin TFA is a tethered macrocyclic peptide antibiotic, acting specifically on A. baumannii. Zosurabalpin TFA inhibits lipopolysaccharide-transport .
    Zosurabalpin TFA
  • HY-W714002

    HIV Bacterial Infection
    Feglymycin is a HIV replication inhibitor. Feglymycin is also an antibiotic peptide that has antibacterial activity (MIC: 32-64 μg/mL for Staphylococcus aureus) .
    Feglymycin
  • HY-P4848

    Antibiotic Infection
    Dermcidin-1L (human) is an antibiotic peptide secreted by sweat glands. Dermcidin-1L (human) has antimicrobial activity. Dermcidin-1L (human) can be used for the research of inflammatory skin disorders .
    Dermcidin-1L (human)
  • HY-P4200

    Antibiotic Bacterial Infection
    Lugdunin is an antibiotic peptide. Lugdunin inhibits bacteria by dissipating their membrane potential. Lugdunin is active against Gram-positive bacteria, such as S. aureus, and reduces S. aureus skin and nasal colonization. Lugdunin induces LL-37 and CXCL8/MIP-2 in human keratinocytes and mouse skin .
    Lugdunin
  • HY-P0311

    Bacterial Infection
    LAH4, an alpha-helix of the designed amphipathic peptide antibiotic, exhibits potent antimicrobial, nucleic acid transfection and cell penetration activities. LAH4 possesses high plasmid DNA delivery capacities. LAH4 has a strong affinity for anionic lipids found in the outer membrane of bacterial membranes .
    LAH4
  • HY-P0311A

    Bacterial Infection
    LAH4 TFA, an alpha-helix of the designed amphipathic peptide antibiotic, exhibits potent antimicrobial, nucleic acid transfection and cell penetration activities. LAH4 TFA possesses high plasmid DNA delivery capacities. LAH4 TFA has a strong affinity for anionic lipids found in the outer membrane of bacterial membranes .
    LAH4 TFA
  • HY-W142073

    7-Methyltryptophan

    Amino Acid Derivatives Infection
    7-Methyl-DL-tryptophan (7-Methyltryptophan) is an amino acid derivative, which is a key precursor for biosynthesis of many non-ribosomal peptide antibiotics. 7-Methyl-DL-tryptophan plays an important role in synthesis of high-efficiency antibacterial agents and analogues thereof .
    7-Methyl-DL-tryptophan
  • HY-P2302

    Antibiotic Bacterial Fungal Infection
    Defensin HNP-3 human is a cytotoxic antibiotic peptide known as "defensin". Defensin HNP-3 human has inhibitory activity against Staphylococcus aureus, Pseudomonas aeruginosa and Escherichia coli. Defensin HNP-3 human is initially synthesized as the 94 amino acids preproHNP(1-94), which is hydrolyzed to proHNP(20-94) and converted to mature HNP(65-94) after the removal of anion precursors .
    Defensin HNP-3 human
  • HY-P1674A
    Murepavadin TFA
    2 Publications Verification

    POL7080 TFA

    Bacterial Antibiotic Infection
    Murepavadin (POL7080) (TFA), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with MIC50 and MIC90 values both of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
    Murepavadin TFA
  • HY-P1674

    POL7080

    Bacterial Antibiotic Infection
    Murepavadin (POL7080), a 14-amino-acid cyclic peptide, is a highly potent, specific antibiotic. Murepavadin exhibits a potent antimicrobial activity for P. aeruginosa with both MIC50 and MIC90 values of 0.12 mg/L. Murepavadin also can target the lipopolysaccharide transport portin D. Murepavadin can be used for the research of bacterial resistance .
    Murepavadin
  • HY-17566
    Capreomycin sulfate
    1 Publications Verification

    Bacterial Antibiotic Infection
    Capreomycin sulfate is a peptide antibiotic used in combination with other antibiotics for MDR-tuberculosis.
    Capreomycin sulfate
  • HY-P5707

    Antibiotic Bacterial Infection
    Gramicidin B is a nonribosomal peptide antibiotic .
    Gramicidin B
  • HY-P10182

    Antibiotic Infection
    Angiotensin III antipeptide is a peptide antibiotic .
    Angiotensin III antipeptide
  • HY-P5577

    Antibiotic Bacterial Infection Cancer
    Aurein 5.2 is an antibiotic antimicrobial peptide .
    Aurein 5.2
  • HY-P2311

    Endogenous Metabolite Antibiotic
    Defensin HNP-2 human is an endogenous antibiotic peptide and monocyte chemotactic peptide produced by human neutrophils.
    Defensin HNP-2 human
  • HY-P0274

    Bacterial Antibiotic Infection
    PGLa, a 21-residue peptide, is an antimicrobial peptide. PGLa is a member of the magainin family of antibiotic peptides found in frog skin and its secretions .
    PGLa
  • HY-P0274A

    Bacterial Antibiotic Infection
    PGLa TFA, a 21-residue peptide, is an antimicrobial peptide. PGLa TFA is a member of the magainin family of antibiotic peptides found in frog skin and its secretions .
    PGLa TFA
  • HY-P0092
    Cecropin B
    1 Publications Verification

    Cytochrome P450 Bacterial Antibiotic Infection Cancer
    Cecropin B has high level of antimicrobial activity and is considered as a valuable peptide antibiotic.
    Cecropin B
  • HY-P1695

    Ro 09-0198

    Antibiotic Bacterial Infection
    Cinnamycin (Ro 09-0198) is a tetracyclic peptide antibiotic that binds specifically to phosphatidylethanolamine (PE) .
    Cinnamycin
  • HY-P5575

    Antibiotic Bacterial Infection Cancer
    Aurein 3.2 is an antibiotic antimicrobial peptide. Aurein 3.2 also has anticancer activity .
    Aurein 3.2
  • HY-P5576

    Antibiotic Bacterial Infection Cancer
    Aurein 3.3 is an antibiotic antimicrobial peptide. Aurein 3.3 also has anticancer activity .
    Aurein 3.3
  • HY-E70012

    Endogenous Metabolite Infection Metabolic Disease
    Penicillinase is a beta-lactamase. beta-lactamase enzymes inactivate beta-lactam antibiotics by hydrolyzing the peptide bond of the characteristic four-membered beta-lactam ring rendering the antibiotic ineffective .
    Penicillinase
  • HY-P5572

    Antibiotic Fungal Bacterial Infection
    Aurein 2.5 is an antibiotic antimicrobial peptide. Aurein 2.5 has antibacterial and antifungal activity
    Aurein 2.5
  • HY-P10158

    Porcine cathelicidin PMAP-36

    Bacterial Infection
    PMAP-36 is an antimicrobial peptide, with sequence of GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG. PMAP-36 with traditional antibiotics can enhance .
    PMAP-36
  • HY-P5571

    Antibiotic Bacterial Infection
    Aurein 2.4 is an antibiotic antimicrobial peptide. Aurein 2.4 is active against Gram-positive bacterial .
    Aurein 2.4
  • HY-N6708

    Bacterial Antibiotic Infection
    Alamethicin, isolated from Trichoderma viride, is a channel-forming peptide antibiotic and induces voltage-gated conductance in model and cell membranes .
    Alamethicin
  • HY-P1872

    Bacterial Infection
    OV-1, sheep is an alpha-helical antimicrobial ovispirin peptide derived from SMAP29 peptide (sheep), which inhibits several antibiotic-resistant bacterial strains including mucoid and nonmucoid Pseudomonas aeruginosa .
    OV-1, sheep
  • HY-P5570

    Antibiotic Bacterial Infection
    Aurein 2.3 is an antibiotic antimicrobial peptide. Aurein 2.3 partially inhibits E.coli ATPase activity and inhibits cell growth .
    Aurein 2.3
  • HY-W142064

    Antibiotic Others
    Fmoc-L-photo-proline is a photo-crosslinking amino acid which can be incorporated into synthetic peptides using solid-phase Fmoc chemistry. Fmoc-L-photo-proline can synthesis of cyclic peptidomimetic antibiotic and be used for preparation of diverse peptide-based photoaffinity probes research .
    Fmoc-L-photo-proline
  • HY-A0162
    Quinupristin
    1 Publications Verification

    Quinupristin is a streptogramin antibiotic. Quinupristin blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits .
    Quinupristin
  • HY-A0162A

    Bacterial Infection
    Quinupristin mesylate is a streptogramin antibiotic. Quinupristin mesylate blocks peptide bond synthesis to prevent the extension of polypeptide chains and promote the detachment of incomplete protein chains in the bacterial ribosomal subunits .
    Quinupristin mesylate
  • HY-P3270

    Bacterial Antibiotic Infection
    Capreomycin is a macrocyclic peptide antibiotic. Capreomycin can be used for anti-multidrug-resistant-tuberculosis research. Capreomycin can inhibit phenylalanine synthesis in in mycobacterial ribosomes translation
    Capreomycin
  • HY-P1975
    Aureobasidin A
    1 Publications Verification

    Basifungin

    Fungal Parasite Infection Inflammation/Immunology
    Aureobasidin A (Basifungin) is a cyclic peptide antibiotic with oral activity. Aureobasidin A is an inhibitor of inositol phosphorylated ceramide synthetase AUR1. Aureobasidin A has antifungal and antiparasitic activity .
    Aureobasidin A
  • HY-P5620

    Bacterial Infection
    DFTamP1 is an antimicrobial peptide against Staphylococcus aureus USA300 activity (MIC is 3.1 μM) .
    DFTamP1
  • HY-P0269

    Magainin I

    Bacterial Fungal Antibiotic Infection
    Magainin 1 (Magainin I) is an antimicrobial and amphipathic peptide isolated from the skin of Xenopus laevis. Magainin 1 exhibits antibiotic activity against numerous Gram-negative and Gram-positive bacteria .
    Magainin 1
  • HY-118593

    Madumycin II; antibiotic A 2315A

    Antibiotic Infection
    A2315A (Madumycin II) is an alanine-containing streptogramin A antibiotic. A2315A is a potent peptidyl transferase center (PTC) inhibitor. A2315A inhibits the ribosome prior to the first cycle of peptide bond formation .
    A2315A
  • HY-P5708

    Dermaseptin b2

    Antibiotic Fungal Bacterial Infection
    Adenoregulin (Dermaseptin b2) is an antimicrobial peptide antibiotic. Adenoregulin is active against Gram-negative and Gram-positive bacteria, yeast and fungi. Adenoregulin also enhances the binding of agonists to the A1 adenosine receptor .
    Adenoregulin
  • HY-P0269A

    Magainin I TFA

    Bacterial Fungal Antibiotic Infection
    Magainin 1 TFA (Magainin I TFA) is an antimicrobial and amphipathic peptide isolated from the skin of Xenopus laevis. Magainin 1 TFA exhibits antibiotic activity against numerous Gram-negative and Gram-positive bacteria .
    Magainin 1 TFA
  • HY-P5712

    Gramicidin soviet

    Antibiotic Bacterial Infection
    Gramicidin S (Gramicidin soviet) is a cationic cyclic peptide antibiotic. Gramicidin S is active against Gram-negative and Gram-positive bacteria by perturbing integrity of the bacterial membranes. Gramicidin S also inhibits cytochrome bd quinol oxidase .
    Gramicidin S
  • HY-P5288

    Antibiotic Infection Cancer
    BMAP-28 is an antibiotic peptide and an inducer of the mitochondrial permeability transition pore. BMAP-28 induces cell death through opening of the mitochondrial permeability transition pore. BMAP-28 can be used in study of microbial infections and cancer .
    BMAP-28
  • HY-P5573

    Antibiotic Bacterial Infection
    Aurein 2.6 is an antibiotic antimicrobial peptide. Aurein 2.6 is active against Gram-positive bacterial (MIC: 25, 25, 30, 25, 30 μM for M. luteus, S. aureus, S. epidermis, S. mutans, B. subtilis) .
    Aurein 2.6
  • HY-P5574

    Antibiotic Bacterial Infection
    Aurein 3.1 is an antibiotic antimicrobial peptide. Aurein 2.6 is active against Gram-positive bacterial (MIC: 80, 50, 50, 50, 50 μM for M. luteus, S. aureus, S. epidermis, S. mutans, B. subtilis) .
    Aurein 3.1
  • HY-P5016

    Antibiotic Bacterial Fungal Infection Cancer
    CRAMP-18 (mouse) is an antibiotic peptide without hemolytic activity. CRAMP-18 (mouse) has good inhibitory activity against Gram-negative bacteria, such as S. typhimurium and P. aeruginosa. CRAMP-18 (mouse) has the potential to study antifungal, antibacterial and antitumor .
    CRAMP-18 (mouse)
  • HY-P2324
    Gramicidin A
    1 Publications Verification

    Bacterial HIF/HIF Prolyl-Hydroxylase Antibiotic Infection Cancer
    Gramicidin A is a peptide component of gramicidin, an antibiotic mixture originally isolated from B. brevis. Gramicidin A is a highly hydrophobic channel-forming ionophore that forms channels in model membranes that are permeable to monovalent cations. Gramicidin A induces degradation of hypoxia inducible factor 1 α (HIF-1α) .
    Gramicidin A
  • HY-106783
    Polymyxin B nonapeptide
    1 Publications Verification

    Bacterial Antibiotic Infection
    Polymyxin B nonapeptide is a cyclic peptide obtained from Polymyxin B by proteolytic removal of its terminal amino acyl residue. Polymyxin B nonapeptide is less toxic, lacks bactericidal activity, and retains its ability to render gram-negative bacteria susceptible to several antibiotics by permeabilizing their outer membranes .
    Polymyxin B nonapeptide
  • HY-P2312

    HβD-3

    Antibiotic Bacterial Infection
    Human β-defensin-3 (HβD-3) is an antibiotic anti-microbial peptide produced by epithelial cells with antimicrobial activities and reduces the effect of inflammatory cytokine responses. Human β-defensin-3 is against different microbes with IC90 values of 6-25 μg/ml .
    Human β-defensin-3
  • HY-B0239S3

    Isotope-Labeled Compounds Bacterial Antibiotic Infection
    Chloramphenicol-d4 is deuterium labeled Chloramphenicol. Chloramphenicol, a broad-spectrum antibiotic, acts as a potent inhibitor of bacterial protein biosynthesis[1][2]. Chloramphenicol acts primarily on the 50S subunit of bacterial 70S rihosomes and inhibits peptide bond formation by suppressing peptidyl transferase activity[3].
    Chloramphenicol-d4

Inquiry Online

Your information is safe with us. * Required Fields.

Salutation

 

Country or Region *

Applicant Name *

 

Organization Name *

Department *

     

Email Address *

 

Product Name *

Cat. No.

 

Requested quantity *

Phone Number *

     

Remarks

Inquiry Online

Inquiry Information

Product Name:
Cat. No.:
Quantity:
MCE Japan Authorized Agent: